Home ProductsCell Free ProteinAquaporins AqpZ Bacterial Nodulin Like Intrinsic Protein Water Channel Protein
I'm Online Chat Now

Aquaporins AqpZ Bacterial Nodulin Like Intrinsic Protein Water Channel Protein

Aquaporins AqpZ Bacterial Nodulin Like Intrinsic Protein Water Channel Protein
Aquaporins AqpZ Bacterial Nodulin Like Intrinsic Protein Water Channel Protein

Large Image :  Aquaporins AqpZ Bacterial Nodulin Like Intrinsic Protein Water Channel Protein

Product Details:

Brand Name: CELLFREE
Model Number: CF-P-007

Payment & Shipping Terms:

Packaging Details: Vial
Delivery Time: 2 weeks
Detailed Product Description
Position: Membrance Type: Water Channel Protein
Appearance: Lyophilized Or Liquid MW: 23kDa
Tool: Nanodisc CFPS System: E Coli Extract
High Light:

Aquaporins Water Channel Protein

,

AqpZ Water Channel Protein

,

Nodulin Like Intrinsic Protein

We offer Aquaporin-Z, AqpZ, major intrinsic protein, cell-free protein isolated by nanodiscs.

Our Cell-free protein has been Function verificated.

 

Advantage of E.Coli system

 

  1. High protein yield
  2. Simple cultivation and fast cell growth and lysate preparation
  3. Cost-efficient
  4. Easy genetic engineering
  5. Well-established

Introduction

 

Aquaporin Z is considered as channel that permits osmotically driven movement of water in both directions. It is involved in the osmoregulation and in the maintenance of cell turgor during volume expansion in rapidly growing cells. It mediates rapid entry or exit of water in response to abrupt changes in osmolarity.

 

Molecular water channels (aquaporins) allow living cells to adapt to osmotic variations by rapid and specific diffusion of water molecules. Aquaporins are present in animals, plants, algae, fungi and bacteria. Aquaporin Z (AqpZ), was the first water channel to be recognized in prokaryotes.

 

UniProt Protein Name Aquaporin Z
Protein Family Aquaporin
UniProt Gene Name qpZ
UniProt Synonym Gene Names bniP

 

Stucture

 

The 8 A projection map of the AqpZ tetramer in frozen hydrated samples is similar to that of AQP1, consistent with the high sequence homology between these proteins.

 

Target sequence

 

MFRKLAAECFGTFWLVFGGCGSAVLAAGFPELGIGFAGVALAFGLTVLTMAFAVGHISG

GHFNPAVTIGLWAGGRFPAKEVVGYVIAQVVGGIVAAALLYLIASGKTGFDAAASGFAS

NGYGEHSPGGYSMLSALVVELVLSAGFLLVIHGATDKFAPAGFAPIAIGLALTLIHLISIPV

TNTSVNPARSTAVAIFQGGWALEQLWFFWVVPIVGGIIGGLIYRTLLEKRD


 

                  

For Research Use Only. Not for use in diagnostic procedures.

 

 



 

Contact Details
CELLFREE SCIENCE CO., LTD.

Contact Person: Pan Lin

Send your inquiry directly to us (0 / 3000)