Product Details:
Payment & Shipping Terms:
|
Position: | Membrance | Type: | Water Channel Protein |
---|---|---|---|
Appearance: | Lyophilized Or Liquid | MW: | 23kDa |
Tool: | Nanodisc | CFPS System: | E Coli Extract |
High Light: | Aquaporins Water Channel Protein,AqpZ Water Channel Protein,Nodulin Like Intrinsic Protein |
We offer Aquaporin-Z, AqpZ, major intrinsic protein, cell-free protein isolated by nanodiscs.
Our Cell-free protein has been Function verificated.
Advantage of E.Coli system
Introduction
Aquaporin Z is considered as channel that permits osmotically driven movement of water in both directions. It is involved in the osmoregulation and in the maintenance of cell turgor during volume expansion in rapidly growing cells. It mediates rapid entry or exit of water in response to abrupt changes in osmolarity.
Molecular water channels (aquaporins) allow living cells to adapt to osmotic variations by rapid and specific diffusion of water molecules. Aquaporins are present in animals, plants, algae, fungi and bacteria. Aquaporin Z (AqpZ), was the first water channel to be recognized in prokaryotes.
UniProt Protein Name | Aquaporin Z |
Protein Family | Aquaporin |
UniProt Gene Name | qpZ |
UniProt Synonym Gene Names | bniP |
Stucture
The 8 A projection map of the AqpZ tetramer in frozen hydrated samples is similar to that of AQP1, consistent with the high sequence homology between these proteins.
Target sequence
MFRKLAAECFGTFWLVFGGCGSAVLAAGFPELGIGFAGVALAFGLTVLTMAFAVGHISG
GHFNPAVTIGLWAGGRFPAKEVVGYVIAQVVGGIVAAALLYLIASGKTGFDAAASGFAS
NGYGEHSPGGYSMLSALVVELVLSAGFLLVIHGATDKFAPAGFAPIAIGLALTLIHLISIPV
TNTSVNPARSTAVAIFQGGWALEQLWFFWVVPIVGGIIGGLIYRTLLEKRD